PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn253821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 294aa    MW: 31589.8 Da    PI: 6.8648
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn253821genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.53.5e-343690155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt eLHerFv+av+qLGG++kAtPkti+++m vkgLtl+h+kSHLQkYRl
  Achn253821 36 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMAVKGLTLYHLKSHLQKYRL 90
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.533393IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-333391IPR009057Homeodomain-like
SuperFamilySSF466892.69E-173593IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-243691IPR006447Myb domain, plants
PfamPF002491.6E-73889IPR001005SANT/Myb domain
PfamPF143799.8E-27133178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MFSAIGSGVG VHGDFQGLDG PHLAGDPCLV LTTDPKPRLR WTAELHERFV DAVTQLGGPD  60
KATPKTIMRT MAVKGLTLYH LKSHLQKYRL GKQSCKDLPD NSKDASCLAE SQDTDSSASS  120
SSKIAQDLND GYHVTEALRV QMEVQRRLHD QLEVQRRLQL RIEAQGKYLQ SILEKACKVL  180
NDQAAATAGL EAAREELSEL AIKASNDSNG LVPVDALKVP SISELAVSLE NKNPSNLPAR  240
FGDCSIDSCL TSNGSLVSPM GVASQAAAMK KRPRPLFGNG DSVPLEWMIT NSG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1270274KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300173.21e-164myb family transcription factor family protein
SwissprotQ9SAK52e-67APL_ARATH; Myb family transcription factor APL
TrEMBLB9GFX51e-164B9GFX5_POPTR; Myb family transcription factor family protein
STRINGVIT_05s0029g00060.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-112G2-like family protein